PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G1160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 380aa    MW: 42994.8 Da    PI: 4.5172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G1160genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEde+l ++++ +G g+W++ ++  g+ R++k+c++rw +yl
      Gh_D11G1160 14 KGRWTAEEDEILTKYIQTHGEGSWRLLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding57.14.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eEdel++++++ lG++ W++Ia++++ gRt++++k++w++ 
      Gh_D11G1160  67 RGNFTGEEDELIIKLHQSLGNR-WSLIASHLP-GRTDNEIKNYWNSN 111
                      89********************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.616961IPR017930Myb domain
SuperFamilySSF466892.13E-3011108IPR009057Homeodomain-like
SMARTSM007172.3E-131363IPR001005SANT/Myb domain
PfamPF002494.2E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-231568IPR009057Homeodomain-like
CDDcd001673.87E-101661No hitNo description
PROSITE profilePS5129425.3562116IPR017930Myb domain
SMARTSM007171.0E-1766114IPR001005SANT/Myb domain
PfamPF002492.6E-1667111IPR001005SANT/Myb domain
CDDcd001671.75E-1269112No hitNo description
Gene3DG3DSA:1.10.10.604.1E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAE EDEILTKYIQ THGEGSWRLL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNF TGEEDELIIK LHQSLGNRWS LIASHLPGRT DNEIKNYWNS NLSTKMYCFR  120
RLSNQSLPVI LNVTGRKGMK DNRGHSTKKE NNGNSSSNKP MEVFIDEVVP FPSTPSLEKE  180
TFPSAVEDST HLDPYEEDNE RRIGVIPSSC QHTGDGDRYV ENSMLCPTAT DSVVEKETDI  240
FSLFGSTESS GVLCFDNILD NELLQTNGDS TLSRWGLNQV SVDLENSGDL CPNKSAAINK  300
QVESGDCGTG DLTSYFCTTS CFFDDCEVNN ILDWDWERNE LWDEKECIMP SWLWELDYND  360
KDDRLTLENN DLELHGSAVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C7e-26121162105C-Myb DNA-Binding Domain
1msf_C7e-26121162105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490341.10.0PREDICTED: transcription factor MYB12-like
TrEMBLA0A0D2QRE20.0A0A0D2QRE2_G
STRINGPOPTR_0014s11780.16e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17349511
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.14e-71myb domain protein 111